SKU: 46430987681

Mouse IL-17A Protein, His tag

Sale price$126.00 Regular price$140.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 14 - Jul 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-17A Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 17A, IL 17, IL 17A, Cytotoxic T lymphocyte associated antigen 8 (CTLA 8), Il17a, Ctla8, Il17 Accession Q62386 Amino Acid Sequence Protein sequence (Q62386, Thr22 Ala158, with C His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Expression System HEK293 Molecular Weight Predicted MW: 17. 1 kDa Observed

Product Specification


Species Mouse
Synonyms Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8), Il17a, Ctla8, Il17
Accession Q62386
Amino Acid Sequence

Protein sequence (Q62386, Thr22-Ala158, with C-His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46430987681

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2375 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nik
New York, US
★★★★★ 5
Love!
Color: Blue, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
Awesome cases! They really are cool to the touch. I didn’t sleep hot at all. I have a “cut-out” memory foam pillow, and this stretched around it perfectly. It is flexible enough that it doesn’t impede with the cut out. And while the material is “silky,” it doesn’t slide around the pillow while sleeping on it. The zipper feature is perfect. I washed and dried per the tag instructions and they washed very well. Super happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
J
Verified Purchase
Jane - NY
Cuba, US
★★★★★ 5
AMAZING - LOVE THESE!
Color: Blue, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
I've been using these pillow cases for more than 6 months and LOVE them. They are well made, no wrinkling, fraying or wearing out, even with a weekly washing. I love the zippers on them, my pillows fits perfectly in the case and don't constantly escape from the case overnight. They definitely perform as described: they keep me cool at night and don't smell and actually don't make a mess of my hair. I bought an extra one and put it on a pillow I keep close to my body which helps me from overheating during the night. They are a great value for the price, I wish I could get top sheets in the same style as these and I'd be in heaven!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 3
Cool Pillowcases
Color: Gray, Size: Queen (U.S. Standard), Set name: Stretchy and Soft
These pillow cases are silky soft and cool to the touch. They don’t stay as cool as I would like, however, so I find myself moving around on the pillow to find a cool spot or flipping the pillow over. I have washed them several times and the coolness seems to be diminishing. Still, it’s better than a regular cotton pillow case. The zipper is needed and helps keep the material on the pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
S
Verified Purchase
Scott Mautino
Carnegie, US
★★★★★ 5
By far the best cooling pillow case I’ve bought highly recommend
Color: Blue, Size: Standard, Set name: Silky
Highly recommend best cooling pillow case I’ve bought very soft and comfortable seems to be made from good material as well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
R
Verified Purchase
ryguy
Chelsea, US
★★★★★ 5
Soft and smooth cover
Color: Grey, Size: Body(20"X 54")
This is a nice pillow cover overall. The fabric feels good and it's comfortable to sleep on, especially compared to a more basic cotton cover. It is maybe a little thinner than I expected, so if you want something thick and heavy this probably isn't that. But for a soft smooth cover that fits and feels decent, I think it's worth it. No major complaints from me after using it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products