SKU: 46430987681

Mouse IL-17A Protein, His tag

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-17A Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 17A, IL 17, IL 17A, Cytotoxic T lymphocyte associated antigen 8 (CTLA 8), Il17a, Ctla8, Il17 Accession Q62386 Amino Acid Sequence Protein sequence (Q62386, Thr22 Ala158, with C His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Expression System HEK293 Molecular Weight Predicted MW: 17. 1 kDa Observed

Product Specification


Species Mouse
Synonyms Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8), Il17a, Ctla8, Il17
Accession Q62386
Amino Acid Sequence

Protein sequence (Q62386, Thr22-Ala158, with C-His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46430987681

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Joshua Roland
Charlottesville, US
★★★★★ 5
Best choice! Absolutely necessary for anything above basic stock bass.
Bonded to services well, completely removed panel reverberation in my tacoma. Also really made the doors so much quieter even when closing. Very happy with the result. Used only one set on my 01 tacoma 4 door. Installed inside doors on exterior skin panel, over interior door panel access holes (sealing the door to provide backpressure to door speakers (left drains open)), roof panel, and back wall of cab. Achieved about 70% coverage and am very happy. 2 8in SKAR SVR8 at 1oh on walmart power acustic 2500 (only rated to ~800rms at 2oh, forum showed testing at 1oh worked about 1kw) in 6th order with blow through into cab. With cab gain, im over 130db between ~30 and ~50hz. This was a necessary addition!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
R
Verified Purchase
Rob Chapman
Carnegie, US
★★★★★ 5
Nice and sticky
Works as it should. No complaints.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
N
Verified Purchase
Nick Wilson
Houston, US
★★★★★ 5
Mak sure area is clean before you install
This works amazing, easy to use, great quality. Sticks down great, I will be ordering more for sure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
S
Sam
Los Angeles, US
★★★★★ 3
Looks good so far, will update once installed
Have not installed this yet, so this is only a first impression review. I bought it to use in the wheel well area on my truck, so I’ll update later once I actually get it on and see if it makes a real difference. So far it looks good out of the box and seems straightforward enough. One thing I’d recommend is making sure you have a sound deadening roller for install, because I would not try putting this on without one. Too early for me to say how well it works for road noise since it is not installed yet, but I wanted to post my initial thoughts for now and will update later.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
P
Verified Purchase
Phil Cobb
West Palm Beach, US
★★★★★ 5
Great product, very impressed
Looks good, adhesive grabs well, forms well to floor pans. Price is great will be ordering more again. It definitely deadened the tin can sound you can get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026

recommand products