SKU: 46430987681

Mouse IL-17A Protein, His tag

Sale price$126.00 Regular price$140.00
Save 10%

Pay in installments of $35.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IL-17A Protein, His tagProduct Specification Species Mouse Synonyms Interleukin 17A, IL 17, IL 17A, Cytotoxic T lymphocyte associated antigen 8 (CTLA 8), Il17a, Ctla8, Il17 Accession Q62386 Amino Acid Sequence Protein sequence (Q62386, Thr22 Ala158, with C His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Expression System HEK293 Molecular Weight Predicted MW: 17. 1 kDa Observed

Product Specification


Species Mouse
Synonyms Interleukin-17A, IL-17, IL-17A, Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8), Il17a, Ctla8, Il17
Accession Q62386
Amino Acid Sequence

Protein sequence (Q62386, Thr22-Ala158, with C-His tag) TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappa B and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46430987681

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
O
Verified Purchase
Oldvtgal
Natrona Heights, US
★★★★★ 5
For soft, sensually awesome sheets- LOOK no more!
Color: 15 - Sage Green, Size: Full
Would give 10 stars if possible! (And this is a nonpaid for review!) When I received the sheets, instantly I knew that I had the right ones, had bought a down comforter close in color as well.. these sheets? The material is strong yet, soft and warm. So so especially soft, and when I make up the bed, ahhh! plus the corners on the fitted, such a cinch to pull over the mattress, even with a topper on the bed! Feels almost spa-like <3 Very comfy, so far in the winter and in 85 degree heat! Soft and easy peasy to care for, too. Washing is a breeze, dry and fold. So far the only thing I can smell on these sheets is my wonderful detergent! Will purchase again. And possibly, again! Thank you!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
K
Verified Purchase
Kari
Bozeman, US
★★★★★ 5
Fit ✅ Color ✅ Soft ✅
Color: 09 - Brown, Size: King, Color: 09 - Brown, Size: King
Color is exactly as advertised. Feels very soft, fits perfectly. No weird odor and not too warm 🥵. Only downfall I can tell is it seems a bit thin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
M
Verified Purchase
michele schmitz
Alexandria, US
★★★★★ 3
Very thin. You get what you pay for.
Color: 01 - White, Size: Queen
You get what you pay for. I first noticed the softness which was great. The quality is very thin. They are cool which is great. I have not washed them yet. I would suggest washing them on cool and gentle by themselves. And because they are so thin I would fluff dry for an hour if you have that setting. The two things that damages clothes and sheets, etc. are if you have an agitator in your washer, those ruin clothes and the heat you choose for the fabric you’re drying I always wash my clothes on cold. I do not have an agitator anymore and on delicate and thin fabrics, I use fluff dry. It is cool, but it will dry, especially if it is thin and I’ve had to dry my fine delicates a little bit longer on fluff that way they don’t shrink because the shrinking comes in from the heat from the dryer so keep that in mind another good thing to remember if you got white sheets like I did is that when you use your detergent add a little bit of borax or laundry booster and they will help get them clean and sparkly white. I am on the fence about whether I would recommend this or not if you’re tight on money and you take good care of them I would recommend that you get them. I’m a linen freak and I buy mostly expensive sheets and I thought I would try this out so that’s where I’m at.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
S
Verified Purchase
Sarah
Belleville, US
★★★★★ 5
Soft, Complete Set & Great Value
Color: 01 - Grey, Size: California King, Color: 01 - Grey, Size: California King
I’m really impressed with this comforter set! The material is super soft and comfortable, and it feels great for all seasons, not too heavy but still cozy. I love that it comes with everything you need, which makes it a great value for the price. The gray color is exactly as pictured and gives a clean, modern look to the room. After washing, it held up well with no issues. Overall, a great quality set that I would definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
T
Verified Purchase
True Reviews By Red
Pawtucket, US
★★★★★ 5
Holds up beautifully—even after lots of washes
Color: 02 - Olive Green, Size: Queen, Color: 02 - Olive Green, Size: Queen
This is a beautiful bed set and has held up incredibly well over time. I’ve washed it dozens of times now and figured it was finally time to write a review because it still looks and feels great. No issues with quality, stitching, or softness—it’s held up flawlessly. The material is soft, warm, and comfortable, and it really pulls the whole look together in our camper bedroom. Definitely one of those sets that looks good and lasts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026

recommand products